PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000950.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 170aa    MW: 18243.5 Da    PI: 8.5018
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000950.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB105.63.2e-3327116594
                    NF-YB   5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                              ++ +P++ v +im++++P  a+i+++aketvq+cv+efi +vt++a++++++e+rkt++++dl+wa+  lG+  y+e+l+ +++ y
  Itr_sc000950.1_g00002.1  27 QNDIPLSTVLKIMREAIPRSARIAEEAKETVQKCVTEFIHYVTAKANERAKQERRKTVTTEDLIWAMRALGLGSYAEELTDFITDY 112
                              5679********************************************************************************** PP

                    NF-YB  91 rele 94 
                              r ++
  Itr_sc000950.1_g00002.1 113 RATH 116
                              *875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.4E-3428118IPR009072Histone-fold
PfamPF008084.1E-223093IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.0E-2730124IPR009072Histone-fold
PRINTSPR006153.1E-75775No hitNo description
PRINTSPR006153.1E-77694No hitNo description
PRINTSPR006153.1E-795113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MHAGENNANM NADNAAAAGP QRRRTAQNDI PLSTVLKIMR EAIPRSARIA EEAKETVQKC  60
VTEFIHYVTA KANERAKQER RKTVTTEDLI WAMRALGLGS YAEELTDFIT DYRATHVHGR  120
AASHPLPPPP VQQVPFNQGF PVPGFAAGPM NDGAGGSASS FSSPSFGGGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-2530113891Transcription factor HapC (Eurofung)
4g92_B2e-2530113891Transcription factor HapC (Eurofung)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14746510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.15e-30NF-YB family protein